dropload Dropload is a place for you to drop your files off and have them picked up by someone else at a later time. Dropload lets you send large files to others who can retrieve the files at any time. And it's free! in Public bookmarkswith droploadplacefilespickedsomeonetimeby 83 users
Merijn.org am a student from the Netherlands that codes in his free time, and especially CWShredder and HijackThis have become quite popular around here. You can download those here, as well as some other apps I wrote. If you just need help with some piece of (suspected) spyware/foistware, or want someone to take a look at your HijackThis logfile, you are very welcome on the SpywareInfo forums. in Public bookmarkswith studentnetherlandscodesfreetimeespeciallycwshredderhijackthisby 6 users
NewsForge | Open source cracks publishing wide open Once upon a time, publishing was the domain of large corporations. Then came desktop publishing and the tools to produce a book shrank from the cost of an aircraft carrier to the price tag of a PT boat. Now, small publishers on the bleeding edge of technology are fomenting a revolution that may change the publishing market forever. Open source publishing tools, long derided as not being ready for battle, are proving themselves in the trenches of small publishing. in Public bookmarkswith upontimepublishingdomainlargecorporationscamedesktop
StopBadware.org We've all seen it happen: you or someone you know has downloaded something from the internet that seemed harmless enough at the time. Next thing you know, the computer has slowed to a crawl. Pop-up advertising starts to appear out of nowhere. Private information gets sent to some company you've never heard of. And the worst part? Trying to uninstall the software might only make the problem worse. in Public bookmarkswith happensomeonedownloadedinternetseemedharmlesstimenextby 24 users
Stress-testing the Linux kernel Automating software testing allows you to run the same tests over a period of time, ensuring that you are really comparing apples to apples and oranges to oranges. In this article, Linux Test Project team members share methodology, rationale, and the scripts and tools they use to stress-test the Linux kernel. in Public bookmarkswith automatingsoftwaretestingruntestsperiodtimeensuring
Universal Digital Library: Million Book Collection , hosted by Carnegie Mellon University For the first time in history, all the significant literary, artistic, and scientific works of mankind can be digitally preserved and made freely available, in every corner of the world, for our education, study, and appreciation and that of all our future generations. Up until now, the transmission of our cultural heritage has depended on limited numbers of copies in fragile media. The fires of Alexandria irrevocably severed our access to any of the works of the ancients. In a thousand years, only a few of the paper documents we have today will survive the ravages of deterioration, loss, and outright destruction. With no more than 10 million unique book and document editions before the year 1900, and perhaps 100 million since the beginning of recorded h... in Public bookmarkswith artistichistoryliterarymankindscientificsignificanttimeworksby 17 users